{"product_id":"proteintech-11407-1-ap","title":"Proteintech, 11407-1-AP, TACC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TACC2 (11407-1-AP) by Proteintech is a Polyclonal antibody targeting TACC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11407-1-AP targets TACC2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransforming acidic coiled-coil (TACC) proteins are a conserved family of centrosome- and microtubule-interacting proteins that are implicated in cancer. TACC2, also known as anti-zuai-1 (AZU-1), was abundantly expressed in non- and premalignant cells and tissues but was appreciably reduced in breast tumor cell types and in primary tumors, thus TACC2 may act as a tumor suppressor protein and represent a tumor progression marker. Several transcript variants encoding different isoforms have been found for this gene. Chromosome segregation in mitosis is orchestrated by dynamic interaction between spindle microtubule and the kinetochore. Centrosomal TACC2 plays a role in organizing centrosomal microtubules and is required for mitotic spindle maintenance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1923 Product name: Recombinant human TACC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2230-2630 aa of BC015736 Sequence: RKTLPLTTAPEAGEVTPSDSGGQEDSPAKGLSVRLEFDYSEDKSSWDNQQENPPPTKKIGKKPVAKMPLRRPKMKKTPEKLDNTPASPPRSPAEPNDIPIAKGTYTFDIDKWDDPNFNPFSSTSKMQESPKLPQQSYNFDPDTCDESVDPFKTSSKTPSSPSKSPASFEIPASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDPTPAATPETPPVISAVVHATDEEKLAVTNQKWTCMTVDLEADKQDYPQPSDLSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSFEETEALVNTAAKNQHPVPRGLAPNQESHLQVPEKSSQKELEAMGLGTPSEAI Predict reactive species\nFull Name: transforming, acidic coiled-coil containing protein 2\nCalculated Molecular Weight: 2948 aa, 309 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC015736\nGene Symbol: TACC2\nGene ID (NCBI): 10579\nRRID: AB_2200456\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95359\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869435089065,"sku":"11407-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11407-1-ap","provider":"Iright","version":"1.0","type":"link"}