{"product_id":"proteintech-11413-1-ap","title":"Proteintech, 11413-1-AP, COX7A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX7A1 (11413-1-AP) by Proteintech is a Polyclonal antibody targeting COX7A1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11413-1-AP targets COX7A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue,  human brain tissue,  human kidney tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome c oxidase(COX) catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen. Subunit VIIa of mammalian COX exists in at least 2 isoforms, liver and muscle. COX7A1(Cytochrome c oxidase subunit 7A1, mitochondrial) is also named as COX7AH, cytochrome c oxidase subunit VIIa-H, cytochrome c oxidase subunit VIIa-M and is the muscle isoform of COX subunit VIIa. Northern-blot analysis of primate tissues demonstrated that COXVIIa-M mRNA is present only in muscle tissues(PMID:1327965).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1981 Product name: Recombinant human COX7A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC002757 Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN Predict reactive species\nFull Name: cytochrome c oxidase subunit VIIa polypeptide 1 (muscle)\nCalculated Molecular Weight: 79 aa, 9 kDa\nObserved Molecular Weight: 7-9 kDa\nGenBank Accession Number: BC002757\nGene Symbol: COX7A1\nGene ID (NCBI): 1346\nRRID: AB_2085705\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24310\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978532521,"sku":"11413-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11413-1-ap","provider":"Iright","version":"1.0","type":"link"}