{"product_id":"proteintech-11418-2-ap","title":"Proteintech, 11418-2-AP, COX5B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX5B (11418-2-AP) by Proteintech is a Polyclonal antibody targeting COX5B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11418-2-AP targets COX5B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX5B belongs to the cytochrome c oxidase subunit 5B family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX5B and other 3 genes CKB, HBB, MBP are involved in respiration.(PMID:21295140)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1986 Product name: Recombinant human COX5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC006229 Sequence: MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH Predict reactive species\nFull Name: cytochrome c oxidase subunit Vb\nCalculated Molecular Weight: 129 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC006229\nGene Symbol: COX5B\nGene ID (NCBI): 1329\nRRID: AB_2245376\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10606\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893204649,"sku":"11418-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11418-2-ap","provider":"Iright","version":"1.0","type":"link"}