{"product_id":"proteintech-11437-1-ap","title":"Proteintech, 11437-1-AP, COX6B2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX6B2 (11437-1-AP) by Proteintech is a Polyclonal antibody targeting COX6B2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11437-1-AP targets COX6B2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX6B2(Cytochrome c oxidase subunit 6B2) encodes the testis-specific cytochrome C oxidase subunit VIb. It has been shown to be expressed in a subset of lung and breast tumors at a level \u0026gt;1% of the testicular level of expression(PMID: 24491090). It belongs to the cytochrome c oxidase subunit 6B family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1983 Product name: Recombinant human COX6B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC064548 Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI Predict reactive species\nFull Name: cytochrome c oxidase subunit VIb polypeptide 2 (testis)\nCalculated Molecular Weight: 88 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC064548\nGene Symbol: COX6B2\nGene ID (NCBI): 125965\nRRID: AB_10859092\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6YFQ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869527855273,"sku":"11437-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11437-1-ap","provider":"Iright","version":"1.0","type":"link"}