{"product_id":"proteintech-11452-1-ap","title":"Proteintech, 11452-1-AP, MIER1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIER1 (11452-1-AP) by Proteintech is a Polyclonal antibody targeting MIER1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11452-1-AP targets MIER1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue,  HepG2 cells,  mouse heart tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2010 Product name: Recombinant human MIER1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC017423 Sequence: SADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY Predict reactive species\nFull Name: mesoderm induction early response 1 homolog (Xenopus laevis)\nCalculated Molecular Weight: 536 aa, 61 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC017423\nGene Symbol: MIER1\nGene ID (NCBI): 57708\nRRID: AB_10733247\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N108\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869472608425,"sku":"11452-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11452-1-ap","provider":"Iright","version":"1.0","type":"link"}