{"product_id":"proteintech-11463-1-ap","title":"Proteintech, 11463-1-AP, COX4I2 Polyclonal antibody","description":"Size: 150ul\nThe COX4I2 (11463-1-AP) by Proteintech is a Polyclonal antibody targeting COX4I2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11463-1-AP targets COX4I2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A375 cells,  human brain tissue,  human heart tissue,  human lung tissue,  MCF-7 cells,  mouse heart tissue,  rat heart tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX4I2, also named as COX4L2 and COXIV-2, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COXIV(cytochrome c oxidase IV) has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. This antibody was generated against full length COX4I2 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1987 Product name: Recombinant human COX4I2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC057779 Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK Predict reactive species\nFull Name: cytochrome c oxidase subunit IV isoform 2 (lung)\nCalculated Molecular Weight: 171 aa, 20 kDa\nObserved Molecular Weight: 17-18 kDa\nGenBank Accession Number: BC057779\nGene Symbol: COX4I2\nGene ID (NCBI): 84701\nRRID: AB_2085287\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96KJ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878655657,"sku":"11463-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11463-1-ap","provider":"Iright","version":"1.0","type":"link"}