{"product_id":"proteintech-11497-1-ap","title":"Proteintech, 11497-1-AP, Apelin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Apelin (11497-1-AP) by Proteintech is a Polyclonal antibody targeting Apelin in IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n11497-1-AP targets Apelin in IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissue, human placenta tissue,  mouse brain tissue,  mouse heart tissue,  mouse placenta tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue, mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApelin, isolated from bovine stomach tissue extractsis, is recognized as the endogenous ligand of the angiotensin-like-receptor 1 (APJ), and the human orphan G-protein-coupled receptor. Apelin  is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. Apelin has been found to be a potent stimulator of cardiac contractility and may function in the regulation of the cardiovascular system. Apelin is also known to be involved in the maintenance of INS sensitivity and play an important role in liver disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2047 Product name: Recombinant human APLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC021104 Sequence: MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF Predict reactive species\nFull Name: apelin\nCalculated Molecular Weight: 77 aa, 9 kDa\nGenBank Accession Number: BC021104\nGene Symbol: Apelin\nGene ID (NCBI): 8862\nRRID: AB_2877771\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULZ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905066665,"sku":"11497-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11497-1-ap","provider":"Iright","version":"1.0","type":"link"}