{"product_id":"proteintech-11511-1-ap","title":"Proteintech, 11511-1-AP, TRIM44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM44 (11511-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM44 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11511-1-AP targets TRIM44 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  human liver tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM44 is one of the family member of TRIM protein, which contains an N-terminal ubiquitin hydrolase-type zinc-finger domain, followed by a coiled-coil domain, a zinc-finger B-box homology domain, and a second coiled-coil domain near the C-terminus. Members of the TRIM protein family are involved in various cellular processes, such as cell proliferation, oncogenesis and antiviral defense. This is a rabbit polyantibody raised against full length of human TRIM44.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2070 Product name: Recombinant human TRIM44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC024031 Sequence: MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEG Predict reactive species\nFull Name: tripartite motif-containing 44\nCalculated Molecular Weight: 344 aa, 38 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC024031\nGene Symbol: TRIM44\nGene ID (NCBI): 54765\nRRID: AB_2303802\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96DX7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868870627497,"sku":"11511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11511-1-ap","provider":"Iright","version":"1.0","type":"link"}