{"product_id":"proteintech-11532-1-ap","title":"Proteintech, 11532-1-AP, NKG7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NKG7 (11532-1-AP) by Proteintech is a Polyclonal antibody targeting NKG7 in WB, IHC, IP, ELISA applications with reactivity to human samples\n11532-1-AP targets NKG7 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NK-92 cells\nPositive IP detected in: NK-92 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNatural killer cell granule protein 7 (NKG7) regulates lymphocyte granule exocytosis and downstream inflammation in a broad range of diseases. NKG7 expressed by CD4+ and CD8+ T cells were key in promoting inflammation during visceral leishmaniasis and malaria-two important parasitic diseases. It is expressed by natural killer cells and is critical for controlling cancer initiation, growth, and metastasis (PMID: 32839608; 8458737).  In brief, NKG7 is a necessary T-cell intrinsic factor for the cytotoxic function of CD8+ T cells and established NKG7 as a new therapeutic target for cancer immunotherapy (PMID: 34911739).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2117 Product name: Recombinant human NKG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC015759 Sequence: MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL Predict reactive species\nFull Name: natural killer cell group 7 sequence\nCalculated Molecular Weight: 165 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC015759\nGene Symbol: NKG7\nGene ID (NCBI): 4818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16617\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887737950377,"sku":"11532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11532-1-ap","provider":"Iright","version":"1.0","type":"link"}