{"product_id":"proteintech-11534-1-ap","title":"Proteintech, 11534-1-AP, Osteoprotegerin\/TNFRSF11B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Osteoprotegerin\/TNFRSF11B (11534-1-AP) by Proteintech is a Polyclonal antibody targeting Osteoprotegerin\/TNFRSF11B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11534-1-AP targets Osteoprotegerin\/TNFRSF11B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk\nPositive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOsteoprotegerin (OPG), also known as tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) and osteoclastogenesis inhibitory factor (OCIF), belongs to the tumor necrosis factor (TNF) receptor superfamily. By binding to RANKL, OPG inhibits osteoclastic activity and promoting bone formationis. OPG plays a key role on cell survival by inhibiting TRAIL-induced apoptosis. OPG also is involved in vascular biology, fibrosis, immunity, EMT, and the apoptosis of cancer cells (PMID: 35523775).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2139 Product name: Recombinant human TNFRSF11B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC030155 Sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCG Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 11b\nCalculated Molecular Weight: 401 aa, 46 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC030155\nGene Symbol: TNFRSF11B\nGene ID (NCBI): 4982\nRRID: AB_3085376\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00300\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985872553,"sku":"11534-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11534-1-ap","provider":"Iright","version":"1.0","type":"link"}