{"product_id":"proteintech-11546-1-ap","title":"Proteintech, 11546-1-AP, NMT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NMT1 (11546-1-AP) by Proteintech is a Polyclonal antibody targeting NMT1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11546-1-AP targets NMT1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, PC-3 cells,  mouse pancreas tissue,  HeLa cells,  L02 cells,  human kidney tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse kidney tissue, human heart tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNMT1 is a N-myristoyltransferase responsible for the transfer of myristate from CoA to an amino-terminal glycine of many eukaryotic proteins, which facilitates the targeting of proteins to membrane surfaces and is essential for viability of the organism. Insertional mutagenesis of the Nmt1 gene in Saccharomyces cerevisiae causes recessive lethality. Humans and mice possess two distinct but structurally similar enzymes, NMT1 and NMT2, ubiquitously expressed in most human and mouse tissues. Western analysis revealed that there are 4 isoforms of NMT1 with apparent molecular masses ranging from 49 to 68 kDa. In cell fractionation studies, the 68-kDa NMT1 isoform and NMT2 were present in both membrane and cytoplasmic fractions, while the smaller NMT1 isoforms were predominantly cytoplasmic.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2072 Product name: Recombinant human NMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC006569 Sequence: MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSL Predict reactive species\nFull Name: N-myristoyltransferase 1\nCalculated Molecular Weight: 496 aa, 57 kDa\nObserved Molecular Weight: 49-68 kDa\nGenBank Accession Number: BC006569\nGene Symbol: NMT1\nGene ID (NCBI): 4836\nRRID: AB_2153157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30419\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868919812265,"sku":"11546-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11546-1-ap","provider":"Iright","version":"1.0","type":"link"}