{"product_id":"proteintech-11547-1-ap","title":"Proteintech, 11547-1-AP, DGKA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DGKA (11547-1-AP) by Proteintech is a Polyclonal antibody targeting DGKA in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11547-1-AP targets DGKA in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  MOLT-4 cells,  human cerebellum tissue,  HEK-293 cells,  mouse cerebellum tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human gliomas tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDGKA(Diacylglycerol kinase alpha) is also named as DAGK, DAGK1 and belongs to the eukaryotic diacylglycerol kinase family,which is suggested to attenuate diacylglycerol-induced cell responses through the phosphorylation of this second messenger to phosphatidic acid.DGKA regulates the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2075 Product name: Recombinant human DGKA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-501 aa of BC023523 Sequence: LEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWS Predict reactive species\nFull Name: diacylglycerol kinase, alpha 80kDa\nCalculated Molecular Weight: 735 aa, 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC023523\nGene Symbol: DGKA\nGene ID (NCBI): 1606\nRRID: AB_2245857\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23743\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868873609385,"sku":"11547-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11547-1-ap","provider":"Iright","version":"1.0","type":"link"}