{"product_id":"proteintech-11549-1-ap","title":"Proteintech, 11549-1-AP, CAMKK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAMKK2 (11549-1-AP) by Proteintech is a Polyclonal antibody targeting CAMKK2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11549-1-AP targets CAMKK2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, fetal human brain tissue,  HeLa cells,  PC-3 cells,  RAW 264.7 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAMKK2(calcium\/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, monkey, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2093 Product name: Recombinant human CAMKK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC026060 Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF Predict reactive species\nFull Name: calcium\/calmodulin-dependent protein kinase kinase 2, beta\nCalculated Molecular Weight: 588 aa, 60 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC026060\nGene Symbol: CAMKK2\nGene ID (NCBI): 10645\nRRID: AB_2259441\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RR4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839989417,"sku":"11549-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11549-1-ap","provider":"Iright","version":"1.0","type":"link"}