{"product_id":"proteintech-11550-1-ap","title":"Proteintech, 11550-1-AP, MEIS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEIS2 (11550-1-AP) by Proteintech is a Polyclonal antibody targeting MEIS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11550-1-AP targets MEIS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, PC-3 cells,  A549 cells,  LNCaP cells,  HCT 116 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEIS2, also named as Meis1-related protein 1 or MRG1, is a 477 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the TALE\/MEIS homeobox family. MEIS2 is expressed in various tissues and at high level in the lymphoid organs of hematopoietic tissues. MEIS2 localizes in the nucleus and is involved in transcriptional regulation. MEIS2 is a critical downstream effector within an essential homeoprotein network that serving a rate-limiting regulatory role in MLL leukemogenesis. MEIS2 as midbrain specific marker is upregulated concomitantly with the morphological transformation of hindbrain to midbrain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2096 Product name: Recombinant human MEIS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC001516 Sequence: MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM Predict reactive species\nFull Name: Meis homeobox 2\nCalculated Molecular Weight: 381 aa, 42 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC001516\nGene Symbol: MEIS2\nGene ID (NCBI): 4212\nRRID: AB_2143028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14770\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559017641,"sku":"11550-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11550-1-ap","provider":"Iright","version":"1.0","type":"link"}