{"product_id":"proteintech-11553-1-ap","title":"Proteintech, 11553-1-AP, CHRNB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRNB1 (11553-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNB1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11553-1-AP targets CHRNB1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAcetylcholine receptors (AChRs) are integral membrane proteins that respond to the binding of acetylcholine (ACh), a neurotransmitter synthesized, stored and finally released by cholinergic neurons. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one each of the beta, delta, and gamma (in immature muscle) or epsilon (in mature muscle) subunits. CHRNB1 gene encodes acetylcholine receptor subunit beta (ACHRB). Mutations in this gene are associated with slow-channel congenital myasthenic syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2108 Product name: Recombinant human CHRNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-501 aa of BC023553 Sequence: CSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP Predict reactive species\nFull Name: cholinergic receptor, nicotinic, beta 1 (muscle)\nCalculated Molecular Weight: 501 aa, 57 kDa\nObserved Molecular Weight: 50-57 kDa\nGenBank Accession Number: BC023553\nGene Symbol: CHRNB1\nGene ID (NCBI): 1140\nRRID: AB_2291854\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11230\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978368681,"sku":"11553-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11553-1-ap","provider":"Iright","version":"1.0","type":"link"}