{"product_id":"proteintech-11555-1-ap","title":"Proteintech, 11555-1-AP, PYGO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PYGO2 (11555-1-AP) by Proteintech is a Polyclonal antibody targeting PYGO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11555-1-AP targets PYGO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-453s cells,  C6 cells,  HeLa cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPYGO2, also named as Pygopus homolog 2, is a 406 animo acid protein, which contains 1 PHD-type zinc finger. PYGO2 is involved in signal transduction through the Wnt pathway and Binds to BCL9 via the PHD-type zinc finger motif, and thereby becomes part of the nuclear beta-catenin\/TCF complex. PYGO2 is in a high proportion of breast and epithelial ovarian malignant tumors and is required for the growth of several cell lines derived from these carcinomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2111 Product name: Recombinant human PYGO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-406 aa of BC032099 Sequence: FGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG Predict reactive species\nFull Name: pygopus homolog 2 (Drosophila)\nCalculated Molecular Weight: 406 aa, 41 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC032099\nGene Symbol: PYGO2\nGene ID (NCBI): 90780\nRRID: AB_2877776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869578973353,"sku":"11555-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11555-1-ap","provider":"Iright","version":"1.0","type":"link"}