{"product_id":"proteintech-11564-1-ap","title":"Proteintech, 11564-1-AP, BMSC UbP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BMSC UbP (11564-1-AP) by Proteintech is a Polyclonal antibody targeting BMSC UbP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11564-1-AP targets BMSC UbP in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HeLa cells,  HepG2 cells,  Jurkat cells,  rat testis tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin is an important cellular signal that targets proteins for degradation or regulates their functions. UBL7 (ORF name SB132) encodes ubiquitin-like protein7 also named bone marrow stromal cell ubiquitin-like protein (BMSC-UbP) capable of binding ubiquitin. BMSC-UbP protein is derived from bone marrow stromal cells containing a ubiquitin-associated (UBA) domain at the C terminus that has been implicated in linking cellular processes and the ubiquitin system. BMSC-UbP mRNA is widely expressed in human multiple tissues and various tumor cell lines and is decreased in BMSC stimulated with phorbol myristate acetate (PMA) suggesting a role in regulation of BMSC function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2130 Product name: Recombinant human UBL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-380 aa of BC030055 Sequence: MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP Predict reactive species\nFull Name: ubiquitin-like 7 (bone marrow stromal cell-derived)\nCalculated Molecular Weight: 380 aa, 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC030055\nGene Symbol: UBL7\nGene ID (NCBI): 84993\nRRID: AB_2212080\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S82\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885254627497,"sku":"11564-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11564-1-ap","provider":"Iright","version":"1.0","type":"link"}