{"product_id":"proteintech-11601-1-ap","title":"Proteintech, 11601-1-AP, IGF2BP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGF2BP2 (11601-1-AP) by Proteintech is a Polyclonal antibody targeting IGF2BP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11601-1-AP targets IGF2BP2 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse kidney tissue,  rat kidney tissue,  human kidney tissue,  human heart tissue,  COLO 320 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human pancreas cancer tissue, human breast cancer tissue,  human colon cancer tissue,  mouse stomach tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInsulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2142 Product name: Recombinant human IGF2BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC021290 Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM Predict reactive species\nFull Name: insulin-like growth factor 2 mRNA binding protein 2\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC021290\nGene Symbol: IGF2BP2\nGene ID (NCBI): 10644\nRRID: AB_2122672\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6M1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823933097,"sku":"11601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11601-1-ap","provider":"Iright","version":"1.0","type":"link"}