{"product_id":"proteintech-11609-1-ap","title":"Proteintech, 11609-1-AP, CPSF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPSF3 (11609-1-AP) by Proteintech is a Polyclonal antibody targeting CPSF3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n11609-1-AP targets CPSF3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, HEK-293 cells,  HepG2 cells,  human brain tissue,  HeLa cells,  Jurkat cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse kidney tissue, human placenta tissue,  human thyroid cancer tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCPSF3 (cleavage and polyadenylation specificity factor 3) is involved in human disease and is the putative target of benzoxaboroles in trypanosomatid parasites and Cryptosporidium infection. CPSF3 has also been associated with cancer malignancy in that CPSF3 induces cell cycle arrest in hepatocellular carcinoma and promotes lung adenocarcinoma cell proliferation and metastasis (PMID: 38718887). CPSF3 has been implicated in various cancers, including lung cancer, colorectal, prostate, and triple-negative breast cancers (PMID: 37627085).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2173 Product name: Recombinant human CPSF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 337-684 aa of BC020211 Sequence: SRELFESWCTDKRNGVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH Predict reactive species\nFull Name: cleavage and polyadenylation specific factor 3, 73kDa\nCalculated Molecular Weight: 684 aa, 77 kDa\nObserved Molecular Weight: 77 kDa\nGenBank Accession Number: BC020211\nGene Symbol: CPSF3\nGene ID (NCBI): 51692\nRRID: AB_2292188\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964409513,"sku":"11609-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11609-1-ap","provider":"Iright","version":"1.0","type":"link"}