{"product_id":"proteintech-11624-1-ap","title":"Proteintech, 11624-1-AP, UHMK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UHMK1 (11624-1-AP) by Proteintech is a Polyclonal antibody targeting UHMK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11624-1-AP targets UHMK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUHMK1, also named as KIS, or KIST, is a 419 amino acid protein, which contains one RRM (RNA recognition motif) domain, one protein kinase domain, and belongs to the protein kinase superfamily. UHMK1 is widely expressed, with highest levels in skeletal muscle, kidney, placenta and peripheral blood leukocytes. UHMK1 localizes in the nucleus and upon serum stimulation, phosphorylating CDKN1B\/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. UHMK1 may be involved in trafficking and\/or processing of RNA and may have a role in the developing nervous system and the adult brain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2204 Product name: Recombinant human UHMK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-344 aa of BC026046 Sequence: GSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSATIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEGLC Predict reactive species\nFull Name: U2AF homology motif (UHM) kinase 1\nCalculated Molecular Weight: 419 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC026046\nGene Symbol: UHMK1\nGene ID (NCBI): 127933\nRRID: AB_2214267\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAS1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991017129,"sku":"11624-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11624-1-ap","provider":"Iright","version":"1.0","type":"link"}