{"product_id":"proteintech-11667-1-ap","title":"Proteintech, 11667-1-AP, NFATC2IP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFATC2IP (11667-1-AP) by Proteintech is a Polyclonal antibody targeting NFATC2IP in WB, IF\/ICC, ELISA applications with reactivity to human samples\n11667-1-AP targets NFATC2IP in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  Raji cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFATC2IP, also named as NIP45, is a 419 amino acid protein, which contains one ubiquitin-like domain. TRAF1 is associated with a fraction of NFATC2IP in the cytoplasm and prevents its translocation to the nucleus. NFATC2IP In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2217 Product name: Recombinant human NFATC2IP protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-218 aa of BC021551 Sequence: PPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG Predict reactive species\nFull Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein\nCalculated Molecular Weight: 138 aa, 15 kDa\nObserved Molecular Weight: 50-65 kDa\nGenBank Accession Number: BC021551\nGene Symbol: NFATC2IP\nGene ID (NCBI): 84901\nRRID: AB_3669129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NCF5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887735853225,"sku":"11667-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11667-1-ap","provider":"Iright","version":"1.0","type":"link"}