{"product_id":"proteintech-11671-1-ap","title":"Proteintech, 11671-1-AP, RAB1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB1A (11671-1-AP) by Proteintech is a Polyclonal antibody targeting RAB1A in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11671-1-AP targets RAB1A in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  NIH\/3T3 cells,  U-251 cells,  rat brain tissue,  U2OS cells\nPositive IP detected in: A549 cells, C2C12 cells\nPositive IHC detected in: human lung cancer tissue, human liver tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C2C12 cells, NIH\/3T3 cells,  A549 cells\nPositive FC (Intra) detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab1A is a member of the Rab family of small GTPases with a well characterized function in the regulation of vesicle trafficking from the endoplasmic reticulum to the Golgi apparatus and within Golgi compartments. Rab1A has recently been reported an mTORC1 activator and a colorectal oncogene (Janice D. Thomas. et al. 2014. Cancer cell).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2264 Product name: Recombinant human RAB1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC000905 Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC Predict reactive species\nFull Name: RAB1A, member RAS oncogene family\nCalculated Molecular Weight: 205 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC000905\nGene Symbol: RAB1A\nGene ID (NCBI): 5861\nRRID: AB_2173437\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62820\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872200361,"sku":"11671-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11671-1-ap","provider":"Iright","version":"1.0","type":"link"}