{"product_id":"proteintech-11688-1-ap","title":"Proteintech, 11688-1-AP, CYP4A11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYP4A11 (11688-1-AP) by Proteintech is a Polyclonal antibody targeting CYP4A11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11688-1-AP targets CYP4A11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat kidney tissue,  mouse kidney tissue\nPositive IHC detected in: human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:300-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYP4A is a member of the CYP4 enzyme family and is involved in the metabolism of medium- and long-chain fatty acids, such as arachidonic acid, palmitate, laurate and compounds with highly regionally selective hydroxylated terminal ω-carbon (PMID: 2554928). CYP4A11 is involved in the development of nonalcoholic fatty liver disease via ROS-induced lipid peroxidation and inflammation (PMID: 32124935). CYP4A11 primarily metabolizes endobiotics and catalyzes the ω-hydroxylation of fatty acids in human liver and kidney tissues (PMID: 34594219). The human CYP4A11 is homologous to mouse CYP4A14 (PMID: 38356602).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2300 Product name: Recombinant human CYP4A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC022851 Sequence: MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP Predict reactive species\nFull Name: cytochrome P450, family 4, subfamily A, polypeptide 11\nCalculated Molecular Weight: 519 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC022851\nGene Symbol: CYP4A11\nGene ID (NCBI): 1579\nRRID: AB_10804774\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02928\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964933801,"sku":"11688-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11688-1-ap","provider":"Iright","version":"1.0","type":"link"}