{"product_id":"proteintech-11695-1-ap","title":"Proteintech, 11695-1-AP, HMGN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMGN1 (11695-1-AP) by Proteintech is a Polyclonal antibody targeting HMGN1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11695-1-AP targets HMGN1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells\nPositive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMGN1 (high-mobility group nucleosome-binding protein 1) is a member of the HMG superfamily of nonhistone chromatin-binding proteins, which which regulate chromatin structure and gene transcription. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may participate in the process which maintains transcribable genes in an unique chromatin conformation, and inhibit the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5\/MSK1 and RPS6KA3\/RSK2 expressed abundantly\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2315 Product name: Recombinant human HMGN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023984 Sequence: MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD Predict reactive species\nFull Name: high-mobility group nucleosome binding domain 1\nCalculated Molecular Weight: 100 aa, 11 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC023984\nGene Symbol: HMGN1\nGene ID (NCBI): 3150\nRRID: AB_2248375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05114\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955627689,"sku":"11695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11695-1-ap","provider":"Iright","version":"1.0","type":"link"}