{"product_id":"proteintech-11708-1-ap","title":"Proteintech, 11708-1-AP, SMN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMN (11708-1-AP) by Proteintech is a Polyclonal antibody targeting SMN in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11708-1-AP targets SMN in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse testis tissue,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human kidney tissue, human brain tissue,  human heart tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissue,  human testis tissue,  mouse brain tissue,  mouse kidney tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSpinal muscular atrophy (SMA) is an autosomal recessive neurodegenerative disease characterized by loss of anterior horn cells in the spinal cord and concomitant symmetrical muscle weakness and atrophy (PMID: 16364894 ). SMA is caused by deletion or mutations of the survival motor neuron (SMN1) gene. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional (PMID: 17355180). A large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein (PMID: 10369862). The level of SMN protein correlates with phenotypic severity of SMA. This antibody, 11708-1-AP, raised against the recombinant full-length human SMN2 protein, recognizes all isoforms of SMN protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2260 Product name: Recombinant human SMN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC000908 Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA Predict reactive species\nFull Name: survival of motor neuron 2, centromeric\nCalculated Molecular Weight: 282 aa, 30 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC000908\nGene Symbol: SMN\nGene ID (NCBI): 6607\nRRID: AB_2255114\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16637\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908736681,"sku":"11708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11708-1-ap","provider":"Iright","version":"1.0","type":"link"}