{"product_id":"proteintech-11759-1-ap","title":"Proteintech, 11759-1-AP, ZNF395 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF395 (11759-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF395 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11759-1-AP targets ZNF395 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF395 is a transcription factors binding to a 7bp GC rich sequence which resides in triplicate at intervals of 13bp within and proximal to the -20bp direct repeat sequences of the Htt promoter. It can bind to regulatory regions in papillomaviruses (PV) and subsequently called the protein papillomavirus binding factor (PBF) [PMID: 11853404]. It contains conserved regions CR1, CR2 and CR3, a domain rich in serines and prolines and have the potential to form a zinc-finger structure, and the C-terminal CR3 is responsible for DNA-binding [PMID: 17897615].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2355 Product name: Recombinant human ZNF395 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-513 aa of BC001237 Sequence: DAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD Predict reactive species\nFull Name: zinc finger protein 395\nCalculated Molecular Weight: 513 aa, 55 kDa\nObserved Molecular Weight: 62 kDa, 72 kDa\nGenBank Accession Number: BC001237\nGene Symbol: ZNF395\nGene ID (NCBI): 55893\nRRID: AB_2218065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H8N7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869510881449,"sku":"11759-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11759-1-ap","provider":"Iright","version":"1.0","type":"link"}