{"product_id":"proteintech-11813-1-ap","title":"Proteintech, 11813-1-AP, CILP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CILP2 (11813-1-AP) by Proteintech is a Polyclonal antibody targeting CILP2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n11813-1-AP targets CILP2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  SW480 cells,  mouse brain tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCILP2, also named as Cartilage intermediate layer protein 2, is a 1156 amino acid protein, which is expressed in articular chondrocytes but not in knee meniscal cartilage cells. CILP2 localizes to the intermediate to deep zone of articular cartilage. CILP2 may play a role in cartilage scaffolding. Given the full-length molecular mass of CILP2 is 125 kDa, but the most CILP2 protein in articular cartilage is cleaved,mostly likely at the furin cleavage site. CILP2 protein is detected as a major band on SDS-page migrating at about 90 kDa. (PMID: 21880736)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2366 Product name: Recombinant human CILP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 304-653 aa of BC034926 Sequence: ALVTATLGGEELEPAPSLPRPLPATVGVTQPYLDRLGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFARVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGGSHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRRVAVNGLLRDYLTRHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEAAQAQARASGPLRTRRGRVRQ Predict reactive species\nFull Name: cartilage intermediate layer protein 2\nCalculated Molecular Weight: 126 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC034926\nGene Symbol: CILP2\nGene ID (NCBI): 148113\nRRID: AB_2877795\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IUL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869656109225,"sku":"11813-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11813-1-ap","provider":"Iright","version":"1.0","type":"link"}