{"product_id":"proteintech-11819-1-ap","title":"Proteintech, 11819-1-AP, C4BPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C4BPA (11819-1-AP) by Proteintech is a Polyclonal antibody targeting C4BPA in WB, IHC, ELISA applications with reactivity to human samples\n11819-1-AP targets C4BPA in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human blood tissue,  human plasma tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC4b-binding protein (C4BP) is a large oligomeric glycoprotein, present in plasma at a concentration of approximately 200 mg\/L (PMID: 24218259). It is the main inhibitor of the classical complement and lectin pathway. C4BP is composed of two polypeptides (alpha and beta chains), which have molecular weights of 70 and 45 kDa, respectively (PMID: 7561113). This polyclonal antibody is raised against the C4BP alpha chain (C4BPA).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2387 Product name: Recombinant human C4BPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 289-597 aa of BC022312 Sequence: PSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL Predict reactive species\nFull Name: complement component 4 binding protein, alpha\nCalculated Molecular Weight: 597 aa, 67 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC022312\nGene Symbol: C4BPA\nGene ID (NCBI): 722\nRRID: AB_2877796\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04003\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869396586665,"sku":"11819-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11819-1-ap","provider":"Iright","version":"1.0","type":"link"}