{"product_id":"proteintech-11821-1-ap","title":"Proteintech, 11821-1-AP, ANKRD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD2 (11821-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11821-1-AP targets ANKRD2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human skeletal muscle tissue,  mouse skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human kidney tissue, human lung tissue,  human skeletal muscle tissue,  human testis tissue,  human brain tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy. Together with Ankrd1\/CARP and DARP, ANKRD2 are members of the MARP mechanosensing proteins that form a complex with titin (N2A)\/calpain 3 protease\/myopalladin. Ankrd2 is thought to have dual, structural and signaling roles, and could link the elastic I-band region as a stress sensor for transcriptional control in the nucleus\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2389 Product name: Recombinant human ANKRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC020817 Sequence: EAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ Predict reactive species\nFull Name: ankyrin repeat domain 2 (stretch responsive muscle)\nCalculated Molecular Weight: 37 aa, 2 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC020817\nGene Symbol: ANKRD2\nGene ID (NCBI): 26287\nRRID: AB_2057858\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZV1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922597545,"sku":"11821-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11821-1-ap","provider":"Iright","version":"1.0","type":"link"}