{"product_id":"proteintech-11845-1-ap","title":"Proteintech, 11845-1-AP, SRPX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRPX2 (11845-1-AP) by Proteintech is a Polyclonal antibody targeting SRPX2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n11845-1-AP targets SRPX2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, human kidney tissue,  human brain tissue,  HepG2 cells\nPositive IHC detected in: human placenta tissue,  human brain tissue,  human heart tissue,  human kidney tissue,  human lung tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSRPX2 (sushi-repeat-containing protein, X-linked 2) is a secreted protein expressed in neurons of the human adult brain, including the rolandic area (PMID: 20874700). Firstly described as sushi-repeat protein up-regulated in leukemia (SPRUL) in leukemia cells with dysregulated expression at the transcriptional level, SRPX2 has been recently shown as a multifunctional protein. SRPX2 is a ligand for uPAR, the urokinase-type plasminogen activator (uPA) receptor (PMID: 18718938). It is involved in seizure disorders, angiogenesis and cellular adhesion (PMID: 22242148; 19667118; 16497722). The involvement of SRPX2 in disorders of language cortex and cognition suggests it has an important role in the perisylvian region critical for language development (PMID: 16497722).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2516 Product name: Recombinant human SRPX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-465 aa of BC020733 Sequence: DGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGASCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE Predict reactive species\nFull Name: sushi-repeat-containing protein, X-linked 2\nCalculated Molecular Weight: 465 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC020733\nGene Symbol: SRPX2\nGene ID (NCBI): 27286\nRRID: AB_2195006\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60687\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961034409,"sku":"11845-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11845-1-ap","provider":"Iright","version":"1.0","type":"link"}