{"product_id":"proteintech-11848-1-ap","title":"Proteintech, 11848-1-AP, Cofilin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cofilin 2 (11848-1-AP) by Proteintech is a Polyclonal antibody targeting Cofilin 2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11848-1-AP targets Cofilin 2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  L02 cells,  mouse liver tissue,  mouse lung tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human normal colon, human gliomas tissue,  human heart tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2408 Product name: Recombinant human CFL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC022876 Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL Predict reactive species\nFull Name: cofilin 2 (muscle)\nCalculated Molecular Weight: 166 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC022876\nGene Symbol: Cofilin 2\nGene ID (NCBI): 1073\nRRID: AB_2080914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y281\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869526053033,"sku":"11848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11848-1-ap","provider":"Iright","version":"1.0","type":"link"}