{"product_id":"proteintech-11850-1-ap","title":"Proteintech, 11850-1-AP, Surfactant Protein A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Surfactant Protein A (11850-1-AP) by Proteintech is a Polyclonal antibody targeting Surfactant Protein A in IHC, ELISA applications with reactivity to human samples\n11850-1-AP targets Surfactant Protein A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung tissue, human heart tissue,  human kidney tissue,  human placenta tissue,  human skin tissue,  human brain tissue,  human spleen tissue,  human ovary tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSurfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2417 Product name: Recombinant human SFTPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-248 aa of BC026229 Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF Predict reactive species\nFull Name: surfactant protein A1\nCalculated Molecular Weight: 248 aa, 26 kDa\nGenBank Accession Number: BC026229\nGene Symbol: Surfactant Protein A\nGene ID (NCBI): 653509\nRRID: AB_2185360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWL2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990165161,"sku":"11850-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11850-1-ap","provider":"Iright","version":"1.0","type":"link"}