{"product_id":"proteintech-11861-1-ap","title":"Proteintech, 11861-1-AP, RAMP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAMP3 (11861-1-AP) by Proteintech is a Polyclonal antibody targeting RAMP3 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n11861-1-AP targets RAMP3 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human kidney tissue,  Jurkat cells,  mouse pancreas tissue,  human placenta tissue,  mouse brain tissue,  mouse heart tissue,  mouse skeletal muscle tissue,  human heart tissue,  mouse lung tissue,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated 58-kD CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2438 Product name: Recombinant human RAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC022304 Sequence: METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL Predict reactive species\nFull Name: receptor (G protein-coupled) activity modifying protein 3\nCalculated Molecular Weight: 16.5 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC022304\nGene Symbol: RAMP3\nGene ID (NCBI): 10268\nRRID: AB_2176465\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60896\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869748940969,"sku":"11861-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11861-1-ap","provider":"Iright","version":"1.0","type":"link"}