{"product_id":"proteintech-11867-1-ap","title":"Proteintech, 11867-1-AP, Ficolin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ficolin 3 (11867-1-AP) by Proteintech is a Polyclonal antibody targeting Ficolin 3 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n11867-1-AP targets Ficolin 3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFicolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles within the innate immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin-3 (Hakata antigen or H-ficolin) was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus (PMID: 1859827). It has been shown to have a calcium-independent lectin activity. Ficolin-3 is associated with MASPs and sMAP, and which activates the lectin pathway (PMID: 11907111). Ficolin-3 shows affinity for GalNAc, GlcNAc, D-fucose and galactose (PMID: 30868077).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2449 Product name: Recombinant human FCN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-288 aa of BC020731 Sequence: CLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR Predict reactive species\nFull Name: ficolin (collagen\/fibrinogen domain containing) 3 (Hakata antigen)\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC020731\nGene Symbol: Ficolin-3\nGene ID (NCBI): 8547\nRRID: AB_2104432\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75636\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406580905,"sku":"11867-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11867-1-ap","provider":"Iright","version":"1.0","type":"link"}