{"product_id":"proteintech-11887-1-ap","title":"Proteintech, 11887-1-AP, PSMA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMA3 (11887-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples\n11887-1-AP targets PSMA3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, PC-12 cells,  human lung tissue,  COS-7 cells,  RAW 264.7 cells,  mouse spleen tissue,  rat brain tissue,  HeLa cells,  NIH\/3T3 cells,  mouse liver tissue\nPositive IHC detected in: human lymphoma tissue, human liver cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMA3(Proteasome subunit alpha type-3) is also named as HC8, PSC8 and belongs to the peptidase T1A family. The proteasome is a multicatalytic protease complex that catalyzes an energy-dependent, extralysosomal proteolytic pathway responsible for selective elimination of proteins with aberrant structures and naturally occurring short-lived proteins related to metabolic regulation and cell cycle progression. It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2495 Product name: Recombinant human PSMA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC029402 Sequence: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, alpha type, 3\nCalculated Molecular Weight: 255 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC029402\nGene Symbol: PSMA3\nGene ID (NCBI): 5684\nRRID: AB_2171420\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25788\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868972306601,"sku":"11887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11887-1-ap","provider":"Iright","version":"1.0","type":"link"}