{"product_id":"proteintech-11900-1-ap","title":"Proteintech, 11900-1-AP, DGKE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DGKE (11900-1-AP) by Proteintech is a Polyclonal antibody targeting DGKE in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11900-1-AP targets DGKE in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDGKE(Diacylglycerol kinase epsilon) is also named as DAGK5 and belongs to the eukaryotic diacylglycerol kinase family.It may be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction(PMID:16689942).When expressed in mammalian cells, DGK-epsilon showed specificity for arachidonyl-containing diacylglycerol.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2512 Product name: Recombinant human DGKE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC022297 Sequence: MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV Predict reactive species\nFull Name: diacylglycerol kinase, epsilon 64kDa\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 60-64 kDa\nGenBank Accession Number: BC022297\nGene Symbol: DGKE\nGene ID (NCBI): 8526\nRRID: AB_2091145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52429\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869456453801,"sku":"11900-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11900-1-ap","provider":"Iright","version":"1.0","type":"link"}