{"product_id":"proteintech-11904-1-ap","title":"Proteintech, 11904-1-AP, RGR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGR (11904-1-AP) by Proteintech is a Polyclonal antibody targeting RGR in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11904-1-AP targets RGR in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: mouse retina tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRGR is a G protein-coupled receptor preferentially expressed at high levels in the retinal pigment epithelium (RPE) and Mueller cells of the neural retina. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. RGR acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. The reverse isomerization occurs with rhodopsin in retinal photoreceptor cells. The gene of PGR may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2552 Product name: Recombinant human RGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC008094 Sequence: MAETSALPTGFGELEVLAVGMVLLVEDPGAADSLPPTGAELGSCGQWDQPECPRCSHIQPSPCLPQALALRLGRLPGSRLPGLCDSVGQHLQQCSHRMGALSPLLHPPKCCHRSHHFEWR Predict reactive species\nFull Name: retinal G protein coupled receptor\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa, 26 kDa\nGenBank Accession Number: BC008094\nGene Symbol: RGR\nGene ID (NCBI): 5995\nRRID: AB_2179498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47804\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887783792809,"sku":"11904-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11904-1-ap","provider":"Iright","version":"1.0","type":"link"}