{"product_id":"proteintech-11905-1-ap","title":"Proteintech, 11905-1-AP, RNF7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF7 (11905-1-AP) by Proteintech is a Polyclonal antibody targeting RNF7 in WB, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n11905-1-AP targets RNF7 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  human heart tissue,  human skeletal muscle tissue,  human testis tissue\nPositive IP detected in: mouse heart tissue\nPositive IF-P detected in: mouse heart tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF (ring finger protein 7 ) is a novel zinc RING finger protein which is redox responsive and protects mammalian cells from apoptosis.It is shown to be localised in the cytoplasmand nucleus of the cell and is expressed in the heart, liver, skeletal muscle predominantly. RNF7 forms oligomers(55 kDa),dimer(28 kDa) and monomer(13 kDa) in the presence of different concentrations of the reductant.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2553 Product name: Recombinant human SAG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC008627 Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK Predict reactive species\nFull Name: ring finger protein 7\nCalculated Molecular Weight: 113 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC008627\nGene Symbol: RNF7\nGene ID (NCBI): 9616\nRRID: AB_10697836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960149673,"sku":"11905-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11905-1-ap","provider":"Iright","version":"1.0","type":"link"}