{"product_id":"proteintech-11915-1-ap","title":"Proteintech, 11915-1-AP, VPREB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPREB3 (11915-1-AP) by Proteintech is a Polyclonal antibody targeting VPREB3 in WB, ELISA applications with reactivity to human samples\n11915-1-AP targets VPREB3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPREB3 (formerly named 8HS20) is a protein that associates with mu chains in the endoplasmic reticulum of pre-B cell lines (PMID: 8491176; 22684248). VPREB3 is normally expressed by precursor B cells in bone marrow and by a subset of normal germinal center B cells in secondary lymphoid organs. It has been reported that VPREB3 expression is associated with B-cell tumors with c-MYC abnormalities (PMID: 20823132).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2528 Product name: Recombinant human VPREB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC020666 Sequence: MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP Predict reactive species\nFull Name: pre-B lymphocyte 3\nCalculated Molecular Weight: 123 aa, 14 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC020666\nGene Symbol: VPREB3\nGene ID (NCBI): 29802\nRRID: AB_2216942\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869792587945,"sku":"11915-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11915-1-ap","provider":"Iright","version":"1.0","type":"link"}