{"product_id":"proteintech-11916-1-ap","title":"Proteintech, 11916-1-AP, RABL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RABL3 (11916-1-AP) by Proteintech is a Polyclonal antibody targeting RABL3 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n11916-1-AP targets RABL3 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  human brain tissue,  human lung tissue,  HUVEC cells,  U-251 cells\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human breast cancer tissue, human liver cancer tissue,  human cervical cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe gene of Rabl3 is located on 3q13.3 and is composed of eight exons and seven introns. It is a member of the Rab subfamily, the largest group in the Ras superfamily of small guanosine triphosphatases (GTPases).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2531 Product name: Recombinant human RABL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC020832 Sequence: MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD Predict reactive species\nFull Name: RAB, member of RAS oncogene family-like 3\nCalculated Molecular Weight: 236 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC020832\nGene Symbol: RABL3\nGene ID (NCBI): 285282\nRRID: AB_2175960\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5HYI8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869579890857,"sku":"11916-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11916-1-ap","provider":"Iright","version":"1.0","type":"link"}