{"product_id":"proteintech-11932-1-ap","title":"Proteintech, 11932-1-AP, PRAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRAP1 (11932-1-AP) by Proteintech is a Polyclonal antibody targeting PRAP1 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n11932-1-AP targets PRAP1 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  mouse pancreas tissue\nPositive IHC detected in: human liver tissue,  human kidney tissue,  mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProline rich acidic protein 1 (PRAP1) is also named as PRO1195 or UPA. It may play an important role in maintaining normal growth homeostasis in epithelial cells. Mitotic arrest deficient 1 (MAD1) is a key component in mitotic checkpoint signalling. Recent study identified PRAP1 as a novel MAD1 binding partner using yeast-two hybrid screening (PMID: 24374861). PRAP1 has four isoforms with MW 16-20 kDa and 10 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2526 Product name: Recombinant human PRAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC029447 Sequence: RLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPENRAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ Predict reactive species\nFull Name: proline-rich acidic protein 1\nCalculated Molecular Weight: 151 aa, 17 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC029447\nGene Symbol: PRAP1\nGene ID (NCBI): 118471\nRRID: AB_10951856\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96NZ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869424406697,"sku":"11932-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11932-1-ap","provider":"Iright","version":"1.0","type":"link"}