{"product_id":"proteintech-11934-1-ap","title":"Proteintech, 11934-1-AP, ARL15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL15 (11934-1-AP) by Proteintech is a Polyclonal antibody targeting ARL15 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11934-1-AP targets ARL15 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue\nPositive IP detected in: mouse thymus tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARL15(ADP-ribosylation factor-like protein 15) is also named as ARFRP2(ADP-ribosylation factor-related protein 2) and belongs to the small GTPase superfamily and Arf familiy.ADP-ribosylation factor-related protein (ARP) is a membrane-associated GTPase with remote similarity to the family of ADP-ribosylation factors (ARF)(PMID:10092663). Arl15 is present in chordates but not lower eukaryotes. Arl15 lacks a site for Nmyristoylation, but the N-terminal region contains several well-conserved cysteines, suggesting that it may bepalmitoylated(PMID:17506703).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2530 Product name: Recombinant human ARL15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC026093 Sequence: MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM Predict reactive species\nFull Name: ADP-ribosylation factor-like 15\nCalculated Molecular Weight: 204 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC026093\nGene Symbol: ARL15\nGene ID (NCBI): 54622\nRRID: AB_2227438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NXU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992786601,"sku":"11934-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11934-1-ap","provider":"Iright","version":"1.0","type":"link"}