{"product_id":"proteintech-11940-1-ap","title":"Proteintech, 11940-1-AP, ARHGAP15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARHGAP15 (11940-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP15 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11940-1-AP targets ARHGAP15 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, Jurkat cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARHGAP15 (Rho GTPase Activating Protein 15) is a Rac1-specific GAP. Diseases associated with ARHGAP15 include Diverticulitis and Meier-Gorlin Syndrome 2. Among its related pathways are Signaling by Rho GTPases and RAC2 GTPase cycle. ARHGAP15 deregulation is implicated in many abnormalities (PMID: 29867200). ARHGAP15 decreased in glioma, which promoted the aggressive phenotypes of glioma cells through the activation of Rac19. Intronic mutation of ARHGAP15 is associated with diverticular disease. In addition, ARHGAP15 was a prognosis-related biomarker for pancreatic ductal adenocarcinoma (PMID: 28979141).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2538 Product name: Recombinant human ARHGAP15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-475 aa of BC016701 Sequence: IILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVPFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED Predict reactive species\nFull Name: Rho GTPase activating protein 15\nCalculated Molecular Weight: 475 aa, 55 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC016701\nGene Symbol: ARHGAP15\nGene ID (NCBI): 55843\nRRID: AB_874081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53QZ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869445050537,"sku":"11940-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11940-1-ap","provider":"Iright","version":"1.0","type":"link"}