{"product_id":"proteintech-11954-1-ap","title":"Proteintech, 11954-1-AP, DYNLT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DYNLT1 (11954-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLT1 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n11954-1-AP targets DYNLT1 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, HEK-293 cells,  human heart tissue,  Sp2\/0 cells\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:600\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (Pubmed: 19448628)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2557 Product name: Recombinant human DYNLT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC029412 Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI Predict reactive species\nFull Name: dynein, light chain, Tctex-type 1\nCalculated Molecular Weight: 113 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC029412\nGene Symbol: DYNLT1\nGene ID (NCBI): 6993\nRRID: AB_2230661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924301481,"sku":"11954-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11954-1-ap","provider":"Iright","version":"1.0","type":"link"}