{"product_id":"proteintech-11971-1-ap","title":"Proteintech, 11971-1-AP, DNAJC2\/MPP11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJC2\/MPP11 (11971-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC2\/MPP11 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11971-1-AP targets DNAJC2\/MPP11 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HEK-293 cells,  HeLa cells,  HepG2 cells,  K-562 cells,  mouse liver tissue,  PC-3 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2594 Product name: Recombinant human MPP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC056682 Sequence: MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKGSPGDSYQKLILQLIHLMKCYLIQ Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 2\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 66-75 kDa\nGenBank Accession Number: BC056682\nGene Symbol: DNAJC2\nGene ID (NCBI): 27000\nRRID: AB_10695893\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99543\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869531656361,"sku":"11971-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11971-1-ap","provider":"Iright","version":"1.0","type":"link"}