{"product_id":"proteintech-11988-1-ap","title":"Proteintech, 11988-1-AP, GNGT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNGT2 (11988-1-AP) by Proteintech is a Polyclonal antibody targeting GNGT2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11988-1-AP targets GNGT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2618 Product name: Recombinant human GNGT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC008663 Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2\nCalculated Molecular Weight: 69 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC008663\nGene Symbol: GNGT2\nGene ID (NCBI): 2793\nRRID: AB_2877813\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14610\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869545484457,"sku":"11988-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11988-1-ap","provider":"Iright","version":"1.0","type":"link"}