{"product_id":"proteintech-12009-1-ap","title":"Proteintech, 12009-1-AP, CAMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAMP (12009-1-AP) by Proteintech is a Polyclonal antibody targeting CAMP in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n12009-1-AP targets CAMP in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, mouse spleen tissue\nPositive IHC detected in: mouse spleen tissue, human lung cancer tissue,  human spleen tissue,  human tonsillitis tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat liver tissue, mouse liver tissue\nPositive IF\/ICC detected in: HeLa cells, THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2622 Product name: Recombinant human CAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC055089 Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Predict reactive species\nFull Name: cathelicidin antimicrobial peptide\nCalculated Molecular Weight: 170 aa, 19 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC055089\nGene Symbol: CAMP\nGene ID (NCBI): 820\nRRID: AB_908736\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49913\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910538921,"sku":"12009-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12009-1-ap","provider":"Iright","version":"1.0","type":"link"}