{"product_id":"proteintech-12015-1-ap","title":"Proteintech, 12015-1-AP, NDRG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDRG2 (12015-1-AP) by Proteintech is a Polyclonal antibody targeting NDRG2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12015-1-AP targets NDRG2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HepG2 cells,  rat brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDRG2, or N-myc downstream-regulated gene 2, is a tumor suppressor gene that plays a significant role in cancer development and progression. It is associated with tumor incidence, progression, and metastasis, and is known to regulate tumor-associated genes. NDRG2 is part of the NDRG family, which includes NDRG1, NDRG2, NDRG3, and NDRG4. These proteins are characterized by an esterase\/lipase\/thioesterase active site serine and an α\/β hydrolase fold of approximately 220 amino acids, although they do not exhibit enzyme activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2629 Product name: Recombinant human NDRG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC010458 Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC Predict reactive species\nFull Name: NDRG family member 2\nCalculated Molecular Weight: 371 aa, 39 kDa\nObserved Molecular Weight: 41-43 kDa\nGenBank Accession Number: BC010458\nGene Symbol: NDRG2\nGene ID (NCBI): 57447\nRRID: AB_10666856\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UN36\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869565046953,"sku":"12015-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12015-1-ap","provider":"Iright","version":"1.0","type":"link"}