{"product_id":"proteintech-12018-1-ap","title":"Proteintech, 12018-1-AP, BAF170 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAF170 (12018-1-AP) by Proteintech is a Polyclonal antibody targeting BAF170 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12018-1-AP targets BAF170 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A431 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human medulloblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAF170, also named as SWI\/SNF complex 170 kDa subunit or SMARCC2, is a 1214 amino acid protein, which belongs to the SMARCC family. BAF170 is ubiquitously expressed. BAF170 is involved in transcriptional activation and repression of select genes by chromatin remodeling. BAF170 may be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. BAF170 belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). The calcualted molecular weight of BAF170, is 133 kDa, but modified BAF170 is about 170 kDa. (PMID: 8804307)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2634 Product name: Recombinant human BAF170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-647 aa of BC013045 Sequence: KRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMY Predict reactive species\nFull Name: SWI\/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2\nCalculated Molecular Weight: 1214 aa, 132 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC013045\nGene Symbol: BAF170\nGene ID (NCBI): 6601\nRRID: AB_2192010\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAQ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869394129065,"sku":"12018-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12018-1-ap","provider":"Iright","version":"1.0","type":"link"}