{"product_id":"proteintech-12035-1-ap","title":"Proteintech, 12035-1-AP, KIF12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF12 (12035-1-AP) by Proteintech is a Polyclonal antibody targeting KIF12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12035-1-AP targets KIF12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, Y79 cells,  mouse pancreas tissue,  rat kidney tissue,  mouse heart tissue\nPositive IHC detected in: human kidney tissue,  human pancreas cancer tissue,  human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF12(kinesin family member 12) is a member of the kinesin superfamily (KIF), which is a microtubule-dependent ATP-driven molecular motor, and its core is involved in the regulation of organelle transport, cell division and metabolic enzyme degradation. Its functional defects are closely related to bile duct diseases, liver diseases and tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2707 Product name: Recombinant human KIF12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC010626 Sequence: MQRTFAWLLDRVQHLGAPVTLRASYLEIYNEQVRDLLSLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAHTLNQASSRSHALLTLYISRQTAQQMPSVDPGEPPVGGKLCFVDLAGSEKVAATGSRGELMLEANSINRSLLALGHCISLLLDPQRKQSHIPFRDSKLTKLLADSLGGRGVTLMVACVSPSAQCLPETLSTLRYASRAQRVTTRPQAPKSPVAKQPQRLETEMLQLQEENRRLQFQLDQMDCKASGLSGARVAWAQRNLYGMLQEFMLENERLRKEKSQLQNSRDLAQNEQRILAQQVHALERRLLSA Predict reactive species\nFull Name: kinesin family member 12\nCalculated Molecular Weight: 646 aa, 71 kDa\nObserved Molecular Weight: 55-70 kDa\nGenBank Accession Number: BC010626\nGene Symbol: KIF12\nGene ID (NCBI): 113220\nRRID: AB_2280813\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96FN5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869001404585,"sku":"12035-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-12035-1-ap","provider":"Iright","version":"1.0","type":"link"}